PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10032129
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 210aa    MW: 23757.6 Da    PI: 8.1443
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10032129genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-162269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a   g++Rt+k+c++rw++yl
      Lus10032129 22 KGPWTMEEDLILINYIANHGEGVWNSLALSAGLKRTGKSCRLRWLNYL 69
                     79********************************************97 PP

2Myb_DNA-binding521.6e-1675118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE+ l+ d++ ++G++ W++Ia++++ gRt++++k++w++
      Lus10032129  75 RGNITLEEQILIMDLHSKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 118
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3251769IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-211872IPR009057Homeodomain-like
SuperFamilySSF466897.11E-3019116IPR009057Homeodomain-like
SMARTSM007176.8E-122171IPR001005SANT/Myb domain
PfamPF002491.1E-152269IPR001005SANT/Myb domain
CDDcd001671.76E-92469No hitNo description
PROSITE profilePS5129423.91670124IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-2473124IPR009057Homeodomain-like
SMARTSM007177.2E-1474122IPR001005SANT/Myb domain
PfamPF002499.0E-1575118IPR001005SANT/Myb domain
CDDcd001675.75E-1179118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MECRTNQPSK EATGGGGEGI RKGPWTMEED LILINYIANH GEGVWNSLAL SAGLKRTGKS  60
CRLRWLNYLR PDVRRGNITL EEQILIMDLH SKWGNRWSKI AKHLPGRTDN EIKNYWRTRI  120
QKHLKPSKLQ SSSPPSSGVD HHHQLDTSHT SQLVSGYNHY YHGADPMEAM MVAECSGSNT  180
TQSDQHSSFE GRHWSMEELW SMELFNAGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-24161241108B-MYB
1h8a_C1e-232012425128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6178261e-106AB617826.1 Linum grandiflorum MYB21 mRNA for transcription factor MYB21, complete cds, cultivar: Red Flax.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613846.13e-79PREDICTED: myb-related protein 305-like
SwissprotP813911e-74MYB05_ANTMA; Myb-related protein 305
TrEMBLG9M8Q21e-103G9M8Q2_9R
STRINGGLYMA16G07960.11e-77(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.19e-71myb domain protein 24